Toutes les photos(2)

Key Documents

COO/COA

SAB1402522

Monoclonal Anti-PITRM1 antibody produced in mouse

Name: Monoclonal Anti-PITRM1 antibody produced in mouse
Brand: SIGMA

clone 1H3, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

KIAA1104, MGC138192, MGC141929, MP1, PreP, hMP1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Toutes les photos(2)

About This Item

Code UNSPSC :

12352203

Nomenclature NACRES :

NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1H3, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~84.48 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

BC001150

Numéro d'accès UniProt

Q5JRX3

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PITRM1(10531)

Immunogène

PITRM1 (AAH01150, 1 a.a. ~ 534 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQIYEKGLELRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLAILGPENPKIAKDPSWIIR

Actions biochimiques/physiologiques

PITRM1 (Pitrilysin metallopeptidase 1) acts as a mitochondrial amyloid-β peptide (Aβ)-degrading enzyme localized in the mitochondrial matrix. Its activity is controlled by Zn(+2)-dependent metalloprotease inhibitor. The temporal lobe of the human brain has a high tendency of Aβ accumulation and reactive oxygen species (ROS) production. In Alzheimer′s disease, the low proteolytic activity of PITRM1 in the brain mitochondria has been reported. Studies have been suggested that high ROS production results in decreased PITRM1 activity followed by Aβ accumulation. As a result, it leads to the mitochondrial toxicity and neuronal death. Thus, it proves the impact of PITRM1 in the Alzheimer′s disease.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Decreased proteolytic activity of the mitochondrial amyloid-β degrading enzyme, PreP peptidasome, in Alzheimer's disease brain mitochondria.

Nyosha Alikhani et al.

Journal of Alzheimer's disease : JAD, 27(1), 75-87 (2011-07-14)

Accumulation of amyloid-β peptide (Aβ), the neurotoxic peptide implicated in the pathogenesis of Alzheimer's disease (AD), has been shown in brain mitochondria of AD patients and of AD transgenic mouse models. The presence of Aβ in mitochondria leads to free

Cloning, expression, and characterization of human metalloprotease 1: a novel member of the pitrilysin family of metalloendoproteases.

N Mzhavia et al.

DNA and cell biology, 18(5), 369-380 (1999-06-09)

A novel cDNA, designated human metalloendoprotease 1 (hMP1), was identified on the basis of homology to known metalloendoproteases of the pitrilysin family. The full-length MP1 codes for a protein with an open reading frame of 1038 amino acids. The N-terminal

Genetic and biochemical studies of SNPs of the mitochondrial A beta-degrading protease, hPreP.

Catarina Moreira Pinho et al.

Neuroscience letters, 469(2), 204-208 (2009-12-08)

Several studies suggest mitochondrial dysfunction as a possible mechanism underlying the development of Alzheimer disease (AD). There is data showing that amyloid-beta (A beta) peptide is present in AD brain mitochondria. The human presequence protease (hPreP) was recently shown to

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique