MSST0043
SILu™Prot TIMP1, Metalloproteinase inhibitor 1 human
recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
23201100
Nomenclature NACRES :
NA.54
Produits recommandés
Description générale
SILu™Prot TIMP1 is a recombinant, stable isotope-labeled human TIMP1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of TIMP1 in mass-spectrometry. SILu™Prot TIMP1 is a protein of 184 amino acids , with a calculated molecular mass of 20.7 kDa.
Actions biochimiques/physiologiques
TIMP-1 is glycoprotein that is over-expressed in the supernatant of tissue extracts of breast, gastric, colorectal, and hepatocellular carcinomas. It belongs to the family of “tissue inhibitors of metalloproteinases,” a group of proteins that help regulate bone turnover. TIMP-1 serum levels are significantly associated with HER2 extracellular domain (ECD)-positivity and poorer disease-free survival among primary breast cancer patients with HER2 overexpression. High levels of serum TIMP-1 correlate with advanced disease and predict for poor survival in patients with multiple myeloma treated with bortezomib and/or IMiDs during their disease course.
Séquence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Forme physique
Supplied as a lyophilized powder containing phosphate buffered saline.
Informations légales
SILu is a trademark of Sigma-Aldrich Co. LLC
Code de la classe de stockage
11 - Combustible Solids
Classe de danger pour l'eau (WGK)
WGK 2
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique