MSST0018

SILu^™Lite IL6 Interleukin 6 human

recombinant, expressed in HEK 293 cells, MS protein standard

• Synonyme(s) : B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, IL-6, Interferon beta-2 (IFN-beta-2)
• Code UNSPSC : 23201100
• Nomenclature NACRES : NA.12

Propriétés

• Source biologique: human
• Niveau de qualité: 200
• Produit recombinant: expressed in HEK 293 cells
• Pureté: ≥98% (SDS-PAGE)
• Forme: lyophilized powder
• Poids mol.: 20812.7
• Technique(s): mass spectrometry (MS): suitable
• Adéquation: suitable for mass spectrometry (internal calibrator)
• Numéro d'accès UniProt: P05231
• Température de stockage: −20°C
• Informations sur le gène: human ... IL6(3569)

Description

Description générale

SILu^™ Lite IL-6 is a recombinant human protein expressed in human 293 cells. It is a monomer of 183 amino acids, with a molecular weight of ~21 kDa. SILu^™ Lite IL-6 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Actions biochimiques/physiologiques

IL-6 is an abundant cytokine, which is crucial for leukocyte and endothelial cell activation. IL-6 is one of the major cytokines that are implicated clinically as biomarkers in ACS (Acute Coronary Syndrome). Its pathophysiological contribution to ACS is the induction of acute-phase response. Patients with ACS have increased circulating levels of IL-6 compared with those patients who have stable angina. Among patients with unstable angina, an increase in IL-6 levels that occurred 48 hours after admission compared with the admission value was associated with the combined end point of death, myocardial infarction (MI), or refractory angina. High levels of IL-6 are also related to cardiovascular disease, heart attack, and stroke.

Séquence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable