MSST0013

SILu^™Prot AMBP Alpha-1 Microglycoprotein human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• Synonyme(s) : Alpha-1-microglobulin, Complex-forming glycoprotein heterogeneous in charge
• Code UNSPSC : 23201100
• Nomenclature NACRES : NA.12

Propriétés

• Source biologique: human
• Niveau de qualité: 200
• Produit recombinant: expressed in HEK 293 cells
• Étiquette/Marqueur: His tagged
• Pureté: ≥98% (SDS-PAGE)
• Forme: lyophilized powder
• Puissance: ≥98% Heavy amino acids incorporation efficiency by MS
• Technique(s): mass spectrometry (MS): suitable
• Adéquation: suitable for mass spectrometry (standard)
• Numéro d'accès UniProt: P02760
• Température de stockage: −20°C
• Informations sur le gène: human ... AMBP(259)

Description

Description générale

SILu^™ Prot AMBP is a recombinant, stable isotope-labeled human AMBP which incorporates ^[13C6, ¹⁵N4]-Arginine and [¹³C6, ¹⁵N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of AMBP in mass-spectrometry. SILu^™ Prot AMBP is a monomer of 204 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~23 kDa.

Actions biochimiques/physiologiques

AMBP is synthesized by the liver, with approximately half of the circulating protein complexed to IgA. The free form is readily filtered by the glomerulus and reabsorbed by proximal tubule cells. AMBP has been found to be a sensitive biomarker for proximal tubular dysfunction even in the early phase of injury when no histologic damage is observable. In addition, urinary AMBP has been proposed to be a useful marker of tubular dysfunction even in low-gestational-age preterm infants, a population at high risk for AKI (Acute Kidney Injury).

Séquence

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVDYKDDDDKGHHHHHHHHGGQ

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Informations légales

SILu is a trademark of Sigma-Aldrich Co. LLC

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable