Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

HPA042257

Sigma-Aldrich

Anti-RP1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

MAPRE2, Microtubule-associated protein RP/EB family member 2, Anti-Dcdc4a, Anti-Retinitis pigmentosa 1 (autosomal dominant)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Numéro MDL:
MFCD01633308
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA042257
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunohistochemistry: 1:500-1:1000

Séquence immunogène

VTCSPCEMCTVNKAYSPKETCNPSDTFFPSDGYGVDQTSMNKACFLGEVCSLTDTVFSDKACAQKENHTYEGACPIDETYVPVNVCNTIDFLNSKENTYTDNLDSTEELERGDDIQKDLNILTDPEYKNGFNTLVSHQNVSNLSSCG

Numéro d'accès UniProt

P56715

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... RP1(6101)

Description générale

Retinitis pigmentosa-1 (RP1) is a photoreceptor microtubule-associated protein. RP1 belongs to end binding protein 1(EB1) protein family, which interacts with adenomatous polyposis coli (APC). RP1 is located on human chromosome 8.

Immunogène

retinitis pigmentosa 1 (autosomal dominant) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

Retinitis pigmentosa-1 (RP1) regulates microtubule formation. Casein kinase II (CK2) a protein kinase when phosphorylates RP1 at Ser(236) aids cell adhesion.RP1 contributes to maintain the architecture of photoreceptor outer segments. Dysfunctioning of RP1 leads to neurodegenerative diseases. Mutations in RP1 gene is known to cause retinitis pigmentosa. Certain regions of RP1 may also cause autosomal recessive rod-cone dystrophy.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71374

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Targeted next generation sequencing identifies novel mutations in RP1 as a relatively common cause of autosomal recessive rod-cone dystrophy
El Shamie, et al.
BioMed Research International, 2015 (2015)
The retinitis pigmentosa 1 protein is a photoreceptor microtubule-associated protein
Liu, Qin, et al.
The Journal of Neuroscience, 24(29), 6427-6436 (2004)
Linkage mapping of autosomal dominant retinitis pigmentosa (RP1) to the pericentric region of human chromosome 8
Blanton,, et al.
Genomics, 11(4), 857-869 (1991)
RP1 is a phosphorylation target of CK2 and is involved in cell adhesion
Stenner,, et al.
PLoS ONE, 8(7), e67595-e67595 (2013)
Molecular basis for photoreceptor outer segment architecture
Goldberg,, et al.
Progress in Retinal and Eye Research, 55, 52-81 (2016)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique