Accéder au contenu
Merck
Toutes les photos(9)

Key Documents

HPA036985

Sigma-Aldrich

Anti-GRSF1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-G-rich RNA sequence binding factor 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(9)

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA036985
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Séquence immunogène

RRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVH

Numéro d'accès UniProt

Q12849

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... GRSF1(2926)

Description générale

The gene GRSF1 (G-rich RNA sequence binding factor 1) is mapped to human chromosome 4q13. It belongs to the hnRNP (heterogeneous nuclear ribonucleoprotein) F/H RNA binding protein family. The protein has three quasi-RNA-recognition motifs and has high affinity for G-rich sequence. The GRSF1 protein is present in the cytoplasm and mitochondrial matrix. It is ubiquitously expressed.

Immunogène

G-rich RNA sequence binding factor 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-GRSF1 antibody produced in rabbit has been used in western blotting.

Actions biochimiques/physiologiques

GRSF1 (G-rich RNA sequence binding factor 1) interacts with cellular and viral mRNAs and brings them to polyribosomes for translation. In the mitochondrial matrix, it controls mitochondrial nascent RNA processing.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST79742

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

miR-346 and miR-138 competitively regulate hTERT in GRSF1- and AGO2-dependent manners, respectively.
Song G, et al.
Scientific Reports, 5, 15793-15793 (2015)
A pseudouridine synthase module is essential for mitochondrial protein synthesis and cell viability.
Antonicka H, et al.
The Embo Journal, 18, 28-38 (2017)
GRSF1 regulates RNA processing in mitochondrial RNA granules.
Jourdain AA, et al.
Cell Metabolism, 17, 399-410 (2013)
Assignment of GRSF1 encoding a poly(A)+ mRNA binding protein to human chromosome 4q13.
Banga SS, et al.
Cytogenetics and Cell Genetics, 73, 295-296 (1996)
The mitochondrial RNA-binding protein GRSF1 localizes to RNA granules and is required for posttranscriptional mitochondrial gene expression.
Antonicka H, et al.
Cell Metabolism, 17, 386-398 (2013)
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique