HPA031531
Anti-CAPZB antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-CD85k, Anti-HM18, Anti-ILT3, Anti-LIR-5, Anti-capping protein (actin filament) muscle Z-line, β
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
mouse, human, rat
Technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
Séquence immunogène
CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... CAPZB(832)
Description générale
CAPZB (capping actin protein of muscle Z-line β subunit) gene is mapped to human chromosome 1p36.13. It is widely expressed in pharyngeal arch, and also in lymphoid cells, seminiferous ducts, urothelium and placenta. The gene codes for β-subunit of the barbed-end F-actin-binding protein.
Immunogène
capping protein (actin filament) muscle Z-line, beta recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CAPZB antibody produced in rabbit has been used in immunoblotting and immunofluorescence procedures.
Actions biochimiques/physiologiques
CAPZB (capping actin protein of muscle Z-line βsubunit) is a heterodimeric protein that caps the growing end of F-actin. This actin-capping protein facilitates the joining of actin filaments to the Z-line of the sarcomere in muscles, thereby modulating the cytoskeleton. The protein regulates actin filament dynamics by blocking actin filament assembly and disassembly, and thereby, modulating cell shape and movement in vitro. It is known to promote cell motility by increasing the depolymerization and capping of actin filaments. CAPZB is associated with tumor progression in cases of epithelioid sarcoma.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST76535
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Purification and characterization of an alpha 1 beta 2 isoform of CapZ from human erythrocytes: cytosolic location and inability to bind to Mg2+ ghosts suggest that erythrocyte actin filaments are capped by adducin.
Biochemistry, 36(44), 13461-13472 (1997)
Actin capping proteins, CapZ (?-actinin) and tropomodulin in amphioxus striated muscle.
Bao Y
Gene, 510(1), 78-86 (2012)
Meta-analysis of two genome-wide association studies identifies four genetic loci associated with thyroid function.
Rawal R
Human Molecular Genetics, 21(14), 3275-3282 (2012)
Actin capping protein CAPZB regulates cell morphology, differentiation, and neural crest migration in craniofacial morphogenesis?.
Mukherjee K
Human Molecular Genetics, 25(7), 1255-1270 (2016)
Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
Zhan M
Human Molecular Genetics, 23(20), 5505-5517 (2014)
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique