HPA018317

Anti-CALHM1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-FAM26C antibody produced in rabbit, Anti-Protein FAM26C
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA018317

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunohistochemistry: 1:50- 1:200
• Séquence immunogène: CTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGW
• Numéro d'accès UniProt: Q8IU99
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CALHM1(255022)

Description

Description générale

The gene CALHM1 (calcium homeostasis modulator protein 1) is mapped to human chromosome 10q24.33. The gene encodes a multipass transmembrane glycoprotein. CALHM1 is present at the endoplasmic reticulum and plasma membrane. It has the ability to homomultimerize. CALHM1 is strongly expressed in adult brain and also in sweet/bitter/umami-sensing typeII taste bud cells.

Immunogène

Calcium homeostasis modulator protein 1 (Protein FAM26C)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

Calcium homeostasis modulator protein 1 (CALHM1) controls cytosolic Ca²⁺ concentrations and amyloid β levels. CALHM1 polymorphism causing disturbance in Ca²⁺ and amyloid β levels is associated with Alzheimer′s disease. CALHM1 is also responsible for Ca²⁺ leakage from the endoplasmic reticulum (ER), thereby causing ER stress. CALHM1 plays crucial role in neuronal excitability. It positively controls the Ca²⁺-dependent activation of dual specificity mitogen-activated protein kinase kinase (MEK), extracellular signal-regulated kinase (ESK), ribosomal S6 kinase (RSK) and mitogen- and stress-activated protein kinase (MSK) signalling pathway in neurons. CALHM1 is also involved in release of taste-stimuli-evoked ATP from sweet-, bitter- and umami-sensing type II taste bud cells.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73092

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)