HPA014963

Anti-SLC13A2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Na(+/dicarboxylate cotransporter 1, Anti-Renal sodium/dicarboxylate cotransporter, Anti-Solute carrier family 13 member 2
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA014963
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunohistochemistry: 1:500-1:1000
• Séquence immunogène: ATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASIGGIATLTGTAPNLVLQGQINSLFPQNGNVV
• Numéro d'accès UniProt: Q13183
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SLC13A2(9058)

Description

Description générale

SLC13A2 (solute carrier family 13, member 2) is a member of the SLC13 family which contains five members. It is a Na⁺-dicarboxylate cotransporter, present in the kidney. It has two N-glycosylation sites present on its C-terminal. Apart from kidney, the mRNA is also found in intestine. It is present on proximal tubular cells, on their apical sides. It is also called Na⁺-coupled dicarboxylate transporters 1 (NaDC1), and is one of the two isoforms of NaDC transporters. This gene is present on human chromosome 17, spans ~30kb, and has around 12 coding exons.

Immunogène

Solute carrier family 13 member 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

SLC13A2 (solute carrier family 13, member 2) is essential for proper citrate excretion, and reabsorbs divalent citrate (citrate^2-) at physiological pH, present as ~10% of the free plasma citrate. Urinary citrate complexes Ca²⁺ ions, and thus prevents nephrolithiasis. Thus, this gene might be associated with the pathophysiology of nephrolithiasis. It is over-expressed in metabolic acidosis, leading to hypocitraturia. Its expression is also down-regulated in metabolic alkalosis. It acts as a transporter for succinate and other dicarboxylates, but with low-affinity.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73200

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)