HPA014685

Anti-MLPH antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Exophilin-3, Anti-Melanophilin, Anti-SlaC2-a, Anti-Slp homolog lacking C2 domains a, Anti-Synaptotagmin-like protein 2a
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA014685

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunohistochemistry: 1:20- 1:50
• Séquence immunogène: ELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFL
• Numéro d'accès UniProt: Q9BV36
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MLPH(79083)

Description

Description générale

MLPH (melanophilin) belongs to the family of synaptotagmin-like proteins and is a Rab27A effector. It is a component of a tripartite complex, which also includes myosin-Va and Rab27A. Its N-terminal contains an Slp homolody domain (SHD), which interacts with GTP-bound form of Rab27A/B, and a myosin Va-binding region in its C-terminal. Also, amino acids 400-590 in the C-terminal, directly bind to actin. It contains two α-helices (SHD1 and SHD2), which are conserved in nature. These two regions are intervened by two zinc finger motifs. This gene is localized to human chromosome 2q37.3.

Immunogène

Melanophilin recombinant protein epitope signature tag (PrEST)

Application

Anti-MLPH antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Actions biochimiques/physiologiques

MLPH (melanophilin) acts as a receptor for myosin-Va in melanocytes. It forms part of a protein complex, which includes myosin-Va and Rab27A, and is essential for the transport of melanosome from perinuclear region to the actin-rich periphery of melanocytes. Thus, normal melanosome distribution is dependent on this protein. It acts as a linker between myosin-Va and Rab27A, and facilitates the binding of melanosomes with actin network. It might also be a key player in the instantaneous skin tanning in humans, when exposed to sun. Mutation in MLPH gene leads to mice with light coat color, called leaden mice. It is the outcome of aberrant melanosome transportation. Homozygous missense mutation occurring in the Slp homology domain of this protein is associated with Griscelli syndrome type III (GSIII). This protein is under-expressed in GSIII melanocytes, and such patients are characterized by silvery-gray hair and hypopigmentation of the skin.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST72718

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable