Accéder au contenu
Merck
Toutes les photos(7)

Principaux documents

HPA011144

Sigma-Aldrich

Anti-PLGRKT antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-C9orf46, Anti-Uncharacterized protein C9orf46 antibody produced in rabbit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41
Conjugué:
unconjugated
application:
IHC
Clone:
polyclonal
Espèces réactives:
mouse, human, rat
citations:
3
Technique(s):
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

mouse, human, rat

Validation améliorée

orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

Séquence immunogène

KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... C9orf46(55848)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Description générale

PLGRKT (plasminogen receptor, C-terminal lysine transmembrane protein) is a transmembrane receptor, which has its C-terminal at the cell surface, containing an exposed lysine residue. It is a plasminogen receptor, and binds to it through its lysine residue. PLGRKT has a molecular weight of 17,261Da, and contains 147 amino acids. It is a highly conserved protein which shows high homology in different species. It has expression levels in catecholaminergic tissues. Its trancript is also expressed in pheochromocytoma tissues, medulla of adrenal gland, hippocampus, cerebral cortex, cerebellum and sympathetic neurons. PLGRKT is also highly expressed in human peripheral blood monocytes and monocytoid cells. This gene is present on the human chromosome 9p24.1.

Immunogène

Uncharacterized protein C9orf46.

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

PLGRKT (plasminogen receptor, C-terminal lysine transmembrane protein) is responsible for the activation of plasminogen, dependent on tissue plasminogen activator (t-PA). It binds to plasminogen through its C-terminal lysine, present on the cell surface, and interacts with t-PA, to activate plasminogen. It also co-localizes with urokinase-type plasminogen activator (uPA) receptor (uPAR), in human monocytes. PLGRKT is involved in migration, invasion, and recruitment of monocytes/macrophages in the inflammatory response, through uPA-dependent plasminogen activation. It is expressed in neuronal and neuroendocrine tissues, and might be implicated in the processes connecting plasminogen activation and catecholamine release.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71769

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Nicholas M Andronicos et al.
Blood, 115(7), 1319-1330 (2009-11-10)
Activation of plasminogen, the zymogen of the primary thrombolytic enzyme, plasmin, is markedly promoted when plasminogen is bound to cell surfaces, arming cells with the broad spectrum proteolytic activity of plasmin. In addition to its role in thrombolysis, cell surface
Shahrzad Lighvani et al.
Blood, 118(20), 5622-5630 (2011-09-24)
Localization of plasmin on macrophages and activation of pro-MMP-9 play key roles in macrophage recruitment in the inflammatory response. These functions are promoted by plasminogen receptors exposing C-terminal basic residues on the macrophage surface. Recently, we identified a novel transmembrane
Hongdong Bai et al.
The Journal of biological chemistry, 286(38), 33125-33133 (2011-07-29)
Neurotransmitter release by catecholaminergic cells is negatively regulated by prohormone cleavage products formed from plasmin-mediated proteolysis. Here, we investigated the expression and subcellular localization of Plg-R(KT), a novel plasminogen receptor, and its role in catecholaminergic cell plasminogen activation and regulation

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique