Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV54586

Sigma-Aldrich

Anti-ACADSB antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-2-MEBCAD, Anti-ACAD7, Anti-Acyl-coenzyme A dehydrogenase, short/branched chain, Anti-SBCAD

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

44 kDa

Espèces réactives

human, rat, mouse, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_001600

Numéro d'accès UniProt

P45954

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ACADSB(36)

Immunogène

Synthetic peptide directed towards the middle region of human ACADSB

Application

Anti-ACADSB antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Actions biochimiques/physiologiques

The protein encoded by ACADSB (Acyl-coenzyme A dehydrogenase, short/branched chain) gene belongs to acyl-CoA dehydrogenases (ACADs) family and is mapped on to chromosome 10 at 10q25-q26. It is a homotetramer with each monomer comprising of a non-covalently bound flavin adenine dinucleotide (FAD) molecule as a cofactor. It catalyzes the initial step of mitochondrial fatty acid β-oxidation for substrates with four and six carbons. ACADSB also catalyzes the third step of leucine and isoleucine/valine metabolism. Deficiency of the encoded protein increases 2-methylbutyrylglycine and 2-methylbutyrylcarnitine in blood and urine and results in catabolism of L-isoleucine.

Séquence

Synthetic peptide located within the following region: GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

B Binzak et al.
Biochimica et biophysica acta, 1382(1), 137-142 (1998-03-21)
The acyl-CoA dehydrogenases (ACDs) are a family of related enzymes which catalyze the alpha,beta-dehydrogenation of acyl-CoA esters, transferring electrons to electron transferring flavoprotein. We have recently cloned and characterized the cDNA for human short/branched chain acyl-CoA dehydrogenase (SBCAD). Based on
Amy K Saenger et al.
Biochemistry, 44(49), 16043-16053 (2005-12-08)
Human short-chain acyl-CoA dehydrogenase (hSCAD) catalyzes the first matrix step in the mitochondrial beta-oxidation cycle for substrates with four and six carbons. Previous studies have shown that the act of substrate/product binding induces a large enzyme potential shift in acyl-CoA
K M Gibson et al.
Pediatric research, 47(6), 830-833 (2000-06-01)
An 4-mo-old male was found to have an isolated increase in 2-methylbutyrylglycine (2-MBG) and 2-methylbutyrylcamitine (2-MBC) in physiologic fluids. In vitro oxidation studies in cultured fibroblasts using 13C- and 14C-labeled branched chain amino acids indicated an isolated block in 2-methylbutyryl-CoA
P Deloukas et al.
Nature, 429(6990), 375-381 (2004-05-28)
The finished sequence of human chromosome 10 comprises a total of 131,666,441 base pairs. It represents 99.4% of the euchromatic DNA and includes one megabase of heterochromatic sequence within the pericentromeric region of the short and long arm of the

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique