AV48196

Anti-CRYAB antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-CRYA2, Anti-CTPP2, Anti-Crystallin, α B, Anti-HSPB5
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 20 kDa
• Espèces réactives: rat, mouse, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_001876
• Numéro d'accès UniProt: P02511
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CRYAB(1410)

Description

Description générale

Crystallin, α B (CRYAB) is a molecular chaperone that holds protein in soluble aggregates. It functions as a tumor suppressor by interacting with adherens junction to inhibit the progression of nasopharyngeal carcinoma. It is also known to inhibit stimulation of CD4+ T cells in relapsing-remitting multiple sclerosis patients.
Rabbit Anti-CRYAB antibody recognizes canine, rabbit, pig, human, mouse, rat, and bovine CRYAB.

Immunogène

Synthetic peptide directed towards the C terminal region of human CRYAB

Application

Rabbit Anti-CRYAB antibody is suitable for western blot applications at a concentration of 5 μg/ml.

Actions biochimiques/physiologiques

Alpha crystallins are composed of: alpha-A and alpha-B, for acidic and basic, respectively. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy.

Séquence

Synthetic peptide located within the following region: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable