Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

AV48116

Sigma-Aldrich

Anti-SLC14A1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-FLJ33745, Anti-FLJ41687, Anti-HUT11, Anti-HsT1341, Anti-JK, Anti-RACH1, Anti-Solute carrier family 14 (urea transporter), member 1 (Kidd blood group), Anti-UT-B1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

42 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_001122060

Numéro d'accès UniProt

Q13336

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC14A1(6563)

Description générale

SLC14A1 codes for a protein that belongs to the solute carrier family. It facilitates the transport of urea in red blood cells and also forms the basis of the Kidd blood grouping system. SLC14A1 has been identified as a susceptibility locus for bladder cancer.
Rabbit Anti-SLC14A1 antibody recognizes human, canine, bovine, and mouse SLC14A1.

Immunogène

Synthetic peptide directed towards the C terminal region of human SLC14A1

Application

Rabbit Anti-SLC14A1 antibody is suitable for western blot applications at a concentration of western blot at a concentration of 0.25 μg/ml and for IHC at 4-8 μg/ml.

Actions biochimiques/physiologiques

SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.

Séquence

Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Montserrat Garcia-Closas et al.
Human molecular genetics, 20(21), 4282-4289 (2011-08-10)
Genome-wide and candidate-gene association studies of bladder cancer have identified 10 susceptibility loci thus far. We conducted a meta-analysis of two previously published genome-wide scans (4501 cases and 6076 controls of European background) and followed up the most significant association

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique