Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

AV47469

Sigma-Aldrich

Anti-SerPINE1 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-PAI, Anti-PAI-1, Anti-PAI1, Anti-PLANH1, Anti-Serpin peptidaSe inhibitor, clade E , member 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

43 kDa

Espèces réactives

bovine, mouse, rabbit, rat, pig, human, sheep

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SERPINE1(5054)

Description générale

SerPINE1 is a serine proteinase inhibitor that blocks fibrinolysis by inhibiting tissue plasminogen activator (tPA) and urokinase (uPA). Genetic variations in SERPINE1 have been linked to pre-eclampsia (PE). Studies have reported that targeting SERPINE1 (PAI-1) expression in Alzheimer′s disease may have therapeutic implications. Moreover, MiR-34c regulates SERPINE1 expression in emphysema.
Rabbit Anti-SerPINE1 antibody recognizes pig, human, mouse, rat, and bovine SERPINE1.

Immunogène

Synthetic peptide directed towards the N terminal region of human SERPINE1

Application

Rabbit Anti-SerPINE1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Actions biochimiques/physiologiques

SERPINE1 acts as ′bait′ for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.

Séquence

Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Stacie M Kutz et al.
Molecular Medicine & Therapeutics, 1(2), 106-106 (2013-07-13)
Accumulation of neurotoxic amyloid peptides (Aβ) in the brain, generated by β-site proteolytic processing of the amyloid precursor protein (APP), is the hallmark pathophysiologic feature of Alzheimer's disease. The plasmin-activating cascade, in which urokinase (uPA) and tissue-type (tPA) plasminogen activators
Santiyagu M Savarimuthu Francis et al.
BMC genomics, 15, 88-88 (2014-02-01)
MicroRNAs (MiRNA) are small non-coding RNAs that regulate gene expression. The aim of this study was to identify miRNAs differentially expressed between mild and moderately emphysematous lung, as well as their functional target mRNAs. Resected lung from patients with COPD
Linlu Zhao et al.
Molecular human reproduction, 19(3), 136-143 (2012-11-28)
The SERPINE1 -675 4G/5G promoter region insertion/deletion polymorphism (rs1799889) has been implicated in the pathogenesis of pre-eclampsia (PE), but the genetic association has been inconsistently replicated. To derive a more precise estimate of the association, a systematic review and meta-analysis

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique