Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

AV47410

Sigma-Aldrich

Anti-TMEM30A antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-C6orf67, Anti-CDC50A, Anti-FLJ10856, Anti-Transmembrane protein 30A

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

41 kDa

Espèces réactives

human, dog, guinea pig, horse, rat, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TMEM30A(55754)

Catégories apparentées

Description générale

TMEM30A codes for a transmembrane protein that is present in the endoplasmic reticulum. Studies have reported that TMEM30A facilitates the import of bioactive and anticancer phospholipids into mammalian cells.
Rabbit Anti-TMEM30A recognizes human, mouse, rat, zebrafish, chicken, canine, and bovine TMEM30A.

Immunogène

Synthetic peptide directed towards the middle region of Human TMEM30A

Application

Rabbit Anti-TMEM30A antibody is suitable for western blot applications at a concentration of 0.25 μg/ml and for immunohistochemistry at 4-8 μg/ml.

Actions biochimiques/physiologiques

The function of this protein remains unknown.

Séquence

Synthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Rui Chen et al.
Journal of immunology (Baltimore, Md. : 1950), 186(5), 3215-3225 (2011-02-04)
Antitumor alkylphospholipids initiate apoptosis in transformed HL-60 and Jurkat cells while sparing their progenitors. 1-O-Alkyl-2-carboxymethyl-sn-glycero-3-phosphocholine (Edelfosine) like other short-chained phospholipids--inflammatory platelet-activating factor (PAF) and apoptotic oxidatively truncated phospholipids--are proposed to have intracellular sites of action, yet a conduit for these
Fan Yang et al.
Haematologica, 104(10), 1984-1994 (2019-03-02)
Transmembrane protein 30A (Tmem30a) is the β-subunit of P4-ATPases which function as flippase that transports aminophospholipids such as phosphatidylserine from the outer to the inner leaflets of the plasma membrane to maintain asymmetric distribution of phospholipids. It has been documented

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique