Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV47013

Sigma-Aldrich

Anti-FJX1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-FLJ22416, Anti-FLJ25593, Anti-Four jointed box 1 (Drosophila)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

48 kDa

Espèces réactives

human, guinea pig, rat, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_055159

Numéro d'accès UniProt

Q86VR8

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FJX1(24147)

Immunogène

Synthetic peptide directed towards the N terminal region of human FJX1

Application

Anti-FJX1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.

Actions biochimiques/physiologiques

FJX1 [four jointed box 1 (Drosophila)] gene encodes for a protein, which is the human ortholog of mouse and drosophila four-jointed gene product that belongs to FJX1/FJ family. Rodent four-jointed ortholog Fjx1 facilitates the regulation of dendrite extension.

Séquence

Synthetic peptide located within the following region: MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Barbara Probst et al.
Developmental biology, 312(1), 461-470 (2007-11-22)
The extrinsic and intrinsic factors that regulate the size and complexity of dendritic arborizations are still poorly understood. Here we identify Fjx1, the rodent ortholog of the Drosophila planar cell polarity (PCP) protein Four-jointed (Fj), as a new inhibitory factor
San Jiun Chai et al.
Human vaccines & immunotherapeutics, 15(1), 167-178 (2018-09-08)
Peptide vaccines derived from tumour-associated antigens have been used as an immunotherapeutic approach to induce specific cytotoxic immune response against tumour. We previously identified that MAGED4B and FJX1 proteins are overexpressed in HNSCC patients; and further demonstrated that two HLA-A2-restricted

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique