AV46706

Anti-ST3GAL3 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-SIAT6, Anti-ST3 β-galactoside α-2,3-sialyltransferase 3, Anti-ST3GALII, Anti-ST3GalIII, Anti-ST3N
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 42 kDa
• Espèces réactives: mouse, guinea pig, rabbit, horse, rat, bovine, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_777623
• Numéro d'accès UniProt: Q11203
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ST3GAL3(6487)

Description

Description générale

ST3 β-galactoside α-2,3-sialyltransferase 3 (ST3GAL3,ST3GalIII, SIAT6) is a sialic acid transferring type II membrane protein found primarily in the Gogi apparatus; wherein sialic acid is transferred from CMP-sialic acid to galactose residues. ST3GAL3 forms the sialyl Lewis epitope on proteins. Defects in ST3GAL3 are associated with cognitive dysfunction.

Spécificité

Anti-ST3GAL3 (AB1) polyclonal antibody reacts with chicken, pig, bovine, canine, human, mouse, and rat β-galactoside α-2,3-sialyltransferase 3 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human ST3GAL3

Application

Anti-ST3GAL3 (AB1) polyclonal antibody is used to tag β-galactoside α-2,3-sialyltransferase 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of β-galactoside α-2,3-sialyltransferase 3 in sialylation of glycoproteins in the Golgi apparatus.

Actions biochimiques/physiologiques

ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene.

Séquence

Synthetic peptide located within the following region: MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable