Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

AV46114

Sigma-Aldrich

Anti-APOBEC3B antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-APOBEC1L, Anti-ARCD3, Anti-ARP4, Anti-Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B, Anti-DJ742C19.2, Anti-FLJ21201, Anti-PHRBNL, Anti-bK150C2.2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

46 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... APOBEC3B(9582)

Catégories apparentées

Immunogène

Synthetic peptide directed towards the N terminal region of human APOBEC3B

Application

Anti-APOBEC3B antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Actions biochimiques/physiologiques

APOBEC3B is a member of the cytidine deaminase gene family and encodes apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B. Endogenous APOBEC3B is a principal nuclear protein that facilitates the DNA C-to-U editing activity in breast cancer cell-line extracts. APOBEC3B exhibits antiviral activity against human T-cell leukemia virus type 1 (HTLV-1) and is a potent inhibitor of simian immunodeficiency virus (SIV) replication.

Séquence

Synthetic peptide located within the following region: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Marcel Ooms et al.
Journal of virology, 86(11), 6097-6108 (2012-03-30)
The human APOBEC3 family consists of seven cytidine deaminases (A3A to A3H), some of which display potent antiretroviral activity against HIV-1 and other retroviruses. Studies that analyzed the effect of A3G on human T-lymphotropic virus type 1 (HTLV-1) infectivity resulted
Michael B Burns et al.
Nature, 494(7437), 366-370 (2013-02-08)
Several mutations are required for cancer development, and genome sequencing has revealed that many cancers, including breast cancer, have somatic mutation spectra dominated by C-to-T transitions. Most of these mutations occur at hydrolytically disfavoured non-methylated cytosines throughout the genome, and
Qin Yu et al.
The Journal of biological chemistry, 279(51), 53379-53386 (2004-10-07)
In the human genome the apolipoprotein B mRNA-editing enzyme catalytic polypeptide (APOBEC)3 gene has expanded into a tandem array of genes termed APOBEC3A-G. Two members of this family, APOBEC3G and APOBEC3F, have been found to have potent activity against virion

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique