Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV44989

Sigma-Aldrich

Anti-SPPL2B antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-IMP4, Anti-KIAA1532, Anti-MGC111084, Anti-PSL1, Anti-Signal peptide peptidase-like 2B

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

56 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SPPL2B(56928)

Description générale

Signal peptide peptidase-like 2B (SPPL2B, IMP4, PSL1), a homologue of signal peptidase, is a GxGD aspartyl protease that catalyzes regulated intra-membrane proteolysis of type II membrane-anchored signaling factors. SPPL2b catabolizes signaling substrates such as TNFα and Bri2.

Spécificité

Anti-SPPL2B polyclonal antibody reacts with human, mouse, rat, chicken, and bovine signal peptide peptidase-like 2B proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human SPPL2B

Application

Anti-SPPL2B polyclonal antibody is used to tag signal peptide peptidase-like 2B for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of signal peptide peptidase-like 2B as a cell signal regulator by mediating the intra-membrane proteolysis of membrane-anchored signaling factors.

Actions biochimiques/physiologiques

SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.

Séquence

Synthetic peptide located within the following region: VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique