Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

AV44817

Sigma-Aldrich

Anti-RHOT1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-ARHT1, Anti-FLJ11040, Anti-FLJ12633, Anti-MIRO-1, Anti-Ras homolog gene family, member T1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Forme d'anticorps

affinity isolated antibody

Niveau de qualité

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

71 kDa

Espèces réactives

rabbit, horse, bovine, rat, human, mouse, guinea pig, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... RHOT1(55288)

Catégories apparentées

Description générale

Anti-RHOT1 polyclonal antibody reacts with RHOT1 in chicken, bovine, human, zebrafish, pig, rat, canine, and mouse.
Ras homolog gene family, member T1 (RHOT1, MIRO-1) is an atypical Rho GTPase involved in calcium sensitive mitochondrial trafficking. Miro interacts with the kinesin-binding proteins GRIF-1 and OIP106 forming a link between the mitochondria and the trafficking apparatus of the microtubules. Miro1 and the kinesin adaptor Grif-1 play an important role in regulating mitochondrial transport in neurons. Miro1 is a calcium sensor for glutamate receptor-dependent localization of mitochondria at synapses.

Immunogène

Synthetic peptide directed towards the N terminal region of human RHOT1

Application

Anti-RHOT1 polyclonal antibody is suitable for use in western blotting and immunohistochemical (IHC) techniques. The antibody is used as a probe to determine the role of RHOT1 in calcium-sensitive mitochondrial trafficking.

Actions biochimiques/physiologiques

Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

Séquence

Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique