Accéder au contenu
Merck
Toutes les photos(4)

Key Documents

AV39521

Sigma-Aldrich

Anti-TEAD1 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-TEA domain family member 1 (SV40 transcriptional enhancer factor)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(4)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

46 kDa

Espèces réactives

horse, bovine, rabbit, human, rat, guinea pig, mouse, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_068780

Numéro d'accès UniProt

P28347

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TEAD1(7003)

Description générale

TEAD1 is a transcriptional factor that blocks the expression of prolactin in human uterine decidual cells. TEAD1 mutation has been linked to Sveinsson′s chorioretinal atrophy.
Rabbit Anti-TEAD1 antibody recognizes pig, zebrafish, human, mouse, rat, bovine, and canine TEAD1.

Immunogène

Synthetic peptide directed towards the C terminal region of human TEAD1

Application

Rabbit Anti-TEAD1 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml and for IHC at 16 μg/ml.

Actions biochimiques/physiologiques

TEAD1 is a transcriptional enhancer. It interacts with a muscle-specific cofactor to promote skeletal muscle gene expression. The mutation in the TEAD1 gene is the cause of Sveinsson′s chorioretinal atrophy

Séquence

Synthetic peptide located within the following region: YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Cherie A Kessler et al.
Molecular and cellular endocrinology, 295(1-2), 32-38 (2008-09-09)
Forced overexpression of TEAD1 in human uterine fibroblast (HUF) and human endometrial stromal cells markedly inhibited prolactin promoter activity in both cell types in a dose-dependent manner, with maximal inhibition of greater than 90%. Conversely, the knockdown of TEAD1 expression
Ragnheidur Fossdal et al.
Human molecular genetics, 13(9), 975-981 (2004-03-16)
Sveinsson's chorioretinal atrophy (SCRA), also referred to as helicoid peripapillary chorioretinal degeneration or atrophia areata, is an autosomal dominant eye disease, characterized by symmetrical lesions radiating from the optic disc involving the retina and the choroid. Genome-wide linkage analysis mapped
Shohei Ikeda et al.
JACC. Basic to translational science, 4(5), 611-622 (2019-11-27)
Patients with diabetes are more prone to developing heart failure in the presence of high blood pressure than those without diabetes. Yes-associated protein (YAP), a key effector of the Hippo signaling pathway, is persistently activated in diabetic hearts, and YAP

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique