Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV39353

Sigma-Aldrich

Anti-DCP1A (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-DCP1 decapping enzyme homolog A (S. cerevisiae)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

56 kDa

Espèces réactives

rat, bovine, horse, guinea pig, human, rabbit, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... DCP1A(55802)

Description générale

DCP1A is an mRNA decapping enzyme that is involved in TGF-β signaling. DCP1A is known to be hyper-phosphorylated during mitosis, cellular stress, neuronal differentiation and brain development. DCP1A has also been implicated in translational arrest.
Rabbit Anti-DCP1A antibody recognizes rat, human, chicken, bovine, canine, zebrafish, and mouse DCP1A.

Immunogène

Synthetic peptide directed towards the N terminal region of human DCP1A

Application

Rabbit Anti-DCP1A antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Actions biochimiques/physiologiques

Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.

Séquence

Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Jacob Blumenthal et al.
FEBS letters, 583(1), 197-201 (2008-12-17)
Decapping protein 1a (Dcp1a) is found in P-bodies and functions in mRNA cap removal prior to its degradation. The function and binding partners of Dcp1a have been thoroughly studied, however its expression pattern is still unclear. In this study we
Jonathan D Dougherty et al.
The Journal of biological chemistry, 289(7), 3936-3949 (2014-01-03)
We have shown previously that poliovirus infection disrupts cytoplasmic P-bodies in infected mammalian cells. During the infectious cycle, poliovirus causes the directed cleavage of Dcp1a and Pan3, coincident with the dispersion of P-bodies. We now show that expression of Dcp1a
Adva Aizer et al.
PloS one, 8(1), e49783-e49783 (2013-01-10)
Processing bodies (PBs) are non-membranous cytoplasmic structures found in all eukaryotes. Many of their components such as the Dcp1 and Dcp2 proteins are highly conserved. Using live-cell imaging we found that PB structures disassembled as cells prepared for cell division

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique