AV38386

Anti-NR5A2 antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-B1F, Anti-B1F2, Anti-CPF, Anti-FTF, Anti-FTZ-F1, Anti-FTZ-F1beta, Anti-LRH-1, Anti-Nuclear receptor subfamily 5, group A, member 2
• Numéro MDL: MFCD07370495
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 61 kDa
• Espèces réactives: human, sheep, bovine
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_003813
• Numéro d'accès UniProt: O00482
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NR5A2(2494)

Description

Description générale

Nuclear receptor subfamily 5, group A, member 2 (NR5A2, BIF2, FTZ-F1β) is a transcription factor involved in cholesterol transport, bile acid homeostasis and steroidogenesis. Also known as liver receptor homolog-1, LRH-1 is expressed primarily in liver, intestine, exocrine pancreas, ovary and embryonic stem cells (ESC). LRH-1 regulates the expression of the key bile acid biosynthetic enzyme cholesterol 7α hydroxylase (Cyp7A1).

Spécificité

Anti-NR5A2 polyclonal antibody reacts with human and bovine nuclear receptor subfamily 5, group A, member 2/ liver receptor homolog-1 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human NR5A2

Application

Anti-NR5A2 polyclonal antibody is used to tag liver receptor homolog-1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of liver receptor homolog-1 in the regulation of bile acid biosynthesis, cholesterol transport and steroidogenesis.

Actions biochimiques/physiologiques

NR5A2 binds to the sequence element 5′-AACGACCGACCTTGAG-3′ of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.

Séquence

Synthetic peptide located within the following region: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGY

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable