AV38089

Anti-E2F3 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-E2F transcription factor 3
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 49 kDa
• Espèces réactives: mouse, human, dog, guinea pig, rat, horse, bovine
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_001940
• Numéro d'accès UniProt: Q68DT0
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... E2F3(1871)

Description

Description générale

E2F transcription factors are key regulators of cell growth, differentiation and cell death. E2F transcription factor 3 (E2F3) can be induced by DNA damage through transcriptional and posttranslational mechanisms wherein it functions as a master regulator of DNA damage response. E2F3, a transcriptional effector that commits cells to enter and progress through S phase, is uniquely amplified in specific human tumours, such as prostate cancer, where its expression is inversely correlated with the survival of patients.

Spécificité

Anti-E2F3 polyclonal antibody reacts with canine, human, mouse, rat, and bovine E2F transcription factor 3 proteins.

Immunogène

Synthetic peptide directed towards the C terminal region of human E2F3

Application

Anti-E2F3 polyclonal antibody is used to tag E2F transcription factor 3 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of E2F transcription factor 3 in the regulation of cell growth, differentiation and cell death and as an oncogene.

Actions biochimiques/physiologiques

E2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.

Séquence

Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable