AV36993

Anti-TFAM (AB3) antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-AI661103, Anti-Hmgts, Anti-MtTFA, Anti-Transcription factor A, mitochondrial, Anti-TsHMG
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.43

Propriétés

• Forme d'anticorps: affinity isolated antibody
• Niveau de qualité: 100
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 27 kDa
• Espèces réactives: rat, mouse, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_033386
• Numéro d'accès UniProt: P40630
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: mouse ... Tfam(21780)

Description

Immunogène

Synthetic peptide directed towards the C terminal region of mouse Tfam

Actions biochimiques/physiologiques

TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.

Séquence

Synthetic peptide located within the following region: FQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable