Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV36000

Sigma-Aldrich

Anti-HES4 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Hairy and enhancer of split 4 (Drosophila)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

24 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... HES4(57801)

Immunogène

Synthetic peptide directed towards the middle region of human HES4

Actions biochimiques/physiologiques

HES4 has been identified as transcriptional repressor that is positively regulated by Wnt signaling pathway. In conjunction with Notch signaling targets, Hes proteins regulate cell differentiation, embryonic patterning and cell fate decisions.

Séquence

Synthetic peptide located within the following region: GHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Kan-Ichiro Nagatomo et al.
Developmental dynamics : an official publication of the American Association of Anatomists, 236(6), 1475-1483 (2007-04-17)
The neural crest is a population of mitotically active, multipotent progenitor cells that arise at the neural plate border. Neural crest progenitors must be maintained in a multipotent state until after neural tube closure. However, the molecular underpinnings of this
Warif El Yakoubi et al.
Stem cells (Dayton, Ohio), 30(12), 2784-2795 (2012-09-13)
The retina of fish and amphibian contains genuine neural stem cells located at the most peripheral edge of the ciliary marginal zone (CMZ). However, their cell-of-origin as well as the mechanisms that sustain their maintenance during development are presently unknown.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique