AV33751

Anti-PARP16 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-Poly(ADP-ribose) polymerase family, member 16
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 36 kDa
• Espèces réactives: mouse, rat, horse, bovine, human, pig
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_060321
• Numéro d'accès UniProt: Q6PK64
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... PARP16(54956)

Description

Description générale

PARP16 is a poly (ADP-ribose) polymerase that catalyzes the post-translational modification of proteins by the addition of multiple ADP-ribose moieties. The are 3 isoforms of parp16 that exists in humans through alternative splicing. The molecular weight of parp16 is 36kDa.

Immunogène

Synthetic peptide directed towards the N terminal region of human PARP16

Actions biochimiques/physiologiques

Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks. A large repertoire of sequences encoding novel PARPs now extends considerably the field of poly(ADP-ribosyl)ation reactions to various aspects of the cell biology including cell proliferation and cell death. Some of these new members interact with each other, share common partners and common subcellular localizations suggesting possible fine tuning in the regulation of this post-translational modification of proteins.

Séquence

Synthetic peptide located within the following region: KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 12 - Non Combustible Liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable