Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV32872

Sigma-Aldrich

Anti-ZBTB7C antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Zinc finger and BTB domain containing 7C

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

69 kDa

Espèces réactives

rat, horse, guinea pig, dog, rabbit, goat, human, mouse, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_001034449

Numéro d'accès UniProt

O73453

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ZBTB7C(201501)

Catégories apparentées

Description générale

ZBTB7C is a zinc-finger protein that functions as a tumor suppressor. Decreased ZBTB7C expression has been linked to cervical carcinoma.
Rabbit Anti-ZBTB7C antibody recognizes rat, mouse, bovine, human, chicken, and canine ZBTB7C.

Immunogène

Synthetic peptide directed towards the N terminal region of human ZBTB7C

Application

Rabbit Anti-ZBTB7C antibody can be used for western blotting applications at a concentration of 5μg/ml.

Actions biochimiques/physiologiques

The function of Anti-ZBTB7C has not yet been determined.

Séquence

Synthetic peptide located within the following region: MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Martina Schmitz et al.
PloS one, 7(6), e39632-e39632 (2012-07-05)
HPV DNA integration into the host genome is a characteristic but not an exclusive step during cervical carcinogenesis. It is still a matter of debate whether viral integration contributes to the transformation process beyond ensuring the constitutive expression of the
Johanna Sandgren et al.
Experimental & molecular medicine, 42(7), 484-502 (2010-06-11)
Epigenomic and genomic changes affect gene expression and contribute to tumor development. The histone modifications trimethylated histone H3 lysine 4 (H3K4me3) and lysine 27 (H3K27me3) are epigenetic regulators associated to active and silenced genes, respectively and alterations of these modifications

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique