Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV31426

Sigma-Aldrich

Anti-TAF10 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30 kDa

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

22 kDa

Espèces réactives

human, rat, bovine, mouse, guinea pig, rabbit, dog, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_006275

Numéro d'accès UniProt

Q12962

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... TAF10(6881)

Description générale

TAF10 is a transcription factor that forms a part of the TFIID and other regulatory complexes (such as SAGA, TFTC, STAGA and PCAF/GCN5). TAF10 is required for mouse embryogenesis and is known to establish skin barrier function in fetal mouse epidermis.
Rabbit Anti-TAF10 antibody recognizes mouse, human, canine, zebrafish, rat, bovine, and pig TAF10.

Immunogène

Synthetic peptide directed towards the C terminal region of human TAF10

Application

Rabbit Anti-TAF10 antibody can be used for western blot applications at 0.5μg/ml.

Actions biochimiques/physiologiques

TAF10 plays a major role in transcription by binding to the TBP-associated factors (TAFs). It interacts with the AF-2-containing region E of the human estrogen receptor (ER). In conjugation with high-mobility group (HMG) protein HMG-1, TAF10 facilitates estrogen receptor-mediated transcriptional activation.

Séquence

Synthetic peptide located within the following region: DALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Arup Kumar Indra et al.
Developmental biology, 285(1), 28-37 (2005-07-26)
TFIID, composed of the TATA box binding protein (TBP) and 13 TBP-associated factors (TAFs), plays a role in nucleating the assembly of the RNA polymerase II preinitiation complexes on protein coding genes. TAF10 (formerly TAF(II)30) is shared between TFIID and
E Scheer et al.
Genomics, 29(1), 269-272 (1995-09-01)
The basal RNA polymerase II transcription factor, TFIID, is composed of the TATA binding protein (TBP) and 8-13 TBP-associated factors (TAFs) ranging from 250 to 17 kDa. The structure of the human gene encoding the 30-kDa subunit of TFIID, TAF2H
C S Verrier et al.
Molecular endocrinology (Baltimore, Md.), 11(8), 1009-1019 (1997-07-01)
The estrogen receptor (ER) belongs to a family of ligand-inducible nuclear receptors that exert their effects by binding to cis-acting DNA elements in the regulatory region of target genes. The detailed mechanisms by which ER interacts with the estrogen response
X Jacq et al.
Cell, 79(1), 107-117 (1994-10-07)
We showed previously that coactivators mediating stimulation by different activators were associated with the TATA-binding protein (TBP) in distinct TFIID complexes. We have characterized a human TBP-associated factor (TAF), hTAFII30, associated with a subset of TFIID complexes. hTAFII30 interacts with
J A Van Der Knaap et al.
The Biochemical journal, 345 Pt 3, 521-527 (2000-01-22)
The TATA-binding protein (TBP) plays a central role in eukaryotic transcription and forms protein complexes with TBP-associated factors (TAFs). The genes encoding TAF(II) proteins frequently map to chromosomal regions altered in human neoplasias. TAF(II)170 of B-TFIID is a member of
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique