Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV13101

Sigma-Aldrich

Anti-GABRG3 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-γ-Aminobutyric acid (GABA) A receptor, γ 3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

54 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_150092

Numéro d'accès UniProt

Q99928

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... GABRG3(2567)

Immunogène

Synthetic peptide directed towards the N terminal region of human GABRG3

Application

Anti-GABRG3 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Actions biochimiques/physiologiques

GABRG3 is a subunit of GABAA receptor, the main inhibitory receptor in the brain. Polymorphisms of GABRG3 gene result in altered responsiveness to GABA and may be involved in alcohol dependence.

Séquence

Synthetic peptide located within the following region: LHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDKKLRP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Danielle M Dick et al.
Alcoholism, clinical and experimental research, 28(1), 4-9 (2004-01-28)
Evidence from human, animal, and in vitro cell models suggests that gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter in the human central nervous system, is involved in many of the neurochemical pathways that affect alcohol use, abuse, and dependence. Both
H Hörtnagl et al.
Neuroscience, 236, 345-372 (2013-01-23)
The GABAA receptor is the main inhibitory receptor in the brain and its subunits originate from different genes or gene families (α1-α6, β1-β3, γ1-γ3, δ, ε, θ, π, or ρ1-3). In the mouse brain the anatomical distribution of GABAA receptor

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique