AMAB91817

Anti-MLANA antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL12864, purified by using Protein A, buffered aqueous glycerol solution

• Synonyme(s) : MART1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Type de produit anticorps: primary antibodies
• Clone: CL12864, monoclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Produit purifié par: using Protein A
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunofluorescence: 2-10 μg/mL; immunohistochemistry: 1:200-1:500; western blot: 1 μg/mL
• Isotype: IgG1
• Numéro d'accès Ensembl | humain: ENSG00000120215
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... MLANA(2315)

Description

Immunogène

Melan-a

Application

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Caractéristiques et avantages

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Séquence

RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP

Liaison

Corresponding Antigen APREST81897

Forme physique

The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Stockage et stabilité

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1