06-596
Anti-STAT3 Antibody
Upstate®, from rabbit
Synonyme(s) :
Acute-phase response factor, DNA-binding protein APRF, signal transducer and activator of transcription, signal transducer and activator of transcription, (acute-phase response factor)
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
eCl@ss :
32160702
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Forme d'anticorps
purified immunoglobulin
Type de produit anticorps
primary antibodies
Clone
polyclonal
Espèces réactives
mouse, human, rat
Fabricant/nom de marque
Upstate®
Technique(s)
ChIP: suitable
electrophoretic mobility shift assay: suitable
immunocytochemistry: suitable
immunoprecipitation (IP): suitable
western blot: suitable
Isotype
IgG
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... STAT3(6774)
mouse ... Stat3(20848)
Description générale
STAT proteins (Signal Transduction and Activators of Transcription) are latent cytoplasmic transcription factors that have the dual function of signal transduction and activation of transcription. STATs are activated by tyrosine phosphorylation in response to different ligands, after which they translocate to the cell nucleus. The N-terminal region is highly homologous among the STAT proteins and surrounds a completely conserved arginine residue. STATs are a part of the JAK-STAT signaling pathway – a major pathway of the immune system. All cytokines transduce critical signals through this pathway. STAT3 has been shown to be activated by IFN alpha but not IFN beta. The transcription factors associated with STAT3 are cJun and cyclic AMP responsive enhancer binding protein (CREB). Deletion of the STAT3 gene in knock out mice was lethal at the early embryonic stage.
Spécificité
Recognizes STAT3, Mr 92 kDa. Additional unknown bands may be detected.
Immunogène
Bacterially expressed GST fusion protein corresponding to a.a. 688-722 of human STAT 3 (RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.
Epitope: a.a. 688-722
Application
Anti-STAT3 Antibody is a Rabbit Polyclonal Antibody for detection of STAT3 also known as Acute-phase response factor or DNA-binding protein APRF & has been validated in ChIP, EMSA, ICC, IP & WB.
Immunoprecipitation:
4 μg of a previous lot immunoprecipitated STAT3 from 500 μg of EGF-stimulated A431 RIPA lysate.
Gel Shift Assay:
An independent laboratory has reported that this antibody supershifts.
Immunocytochemistry:
10 μg/mL of a previous lot of this antibody showed positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid.
4 μg of a previous lot immunoprecipitated STAT3 from 500 μg of EGF-stimulated A431 RIPA lysate.
Gel Shift Assay:
An independent laboratory has reported that this antibody supershifts.
Immunocytochemistry:
10 μg/mL of a previous lot of this antibody showed positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid.
Research Category
Epigenetics & Nuclear Function
Epigenetics & Nuclear Function
Research Sub Category
Transcription Factors
Transcription Factors
Qualité
Routinely evaluated by western blot on RIPA lysates from EGF stimulated human A431 cells, mouse WEHI or rat L6.
Western Blot Analysis:
0.5-2 μg/mL of this lot detected STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6.
Western Blot Analysis:
0.5-2 μg/mL of this lot detected STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6.
Description de la cible
92 kDa
Liaison
Replaces: 04-1014
Forme physique
Format: Purified
Protein A purified
Protein A purified rabbit IgG in 200 L of 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide. Frozen at -20°C.
Stockage et stabilité
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Remarque sur l'analyse
Control
Positive Antigen Control: Catalog #12-302, EGF-stimulated A431 cell lysate. Add 2.5µL of 2-mercaptoethanol/100µL of lysate and boil for 5 minutes to reduce the preparation. Load 20µg of reduced lysate per lane for minigels.
Positive Antigen Control: Catalog #12-302, EGF-stimulated A431 cell lysate. Add 2.5µL of 2-mercaptoethanol/100µL of lysate and boil for 5 minutes to reduce the preparation. Load 20µg of reduced lysate per lane for minigels.
Autres remarques
Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Informations légales
UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Outil de sélection de produits.
Code de la classe de stockage
12 - Non Combustible Liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
The box-1 region of the leukemia inhibitory factor receptor alpha-chain cytoplasmic domain is sufficient for hemopoietic cell proliferation and differentiation
Zhang, Y., et al
The Journal of Biological Chemistry, 273, 34370-34383 (1998)
IL-5 and granulocyte-macrophage colony-stimulating factor activate STAT3 and STAT5 and promote Pim-1 and cyclin D3 protein expression in human eosinophils.
Barbara A Stout, Mary Ellen Bates, Lin Ying Liu, Natasha N Farrington, Paul J Bertics
Journal of immunology (Baltimore, Md. : 1950) (1950)
Glutamine Deprivation Causes Hydrogen Peroxide-induced Interleukin-8 Expression via Jak1/Stat3 Activation in Gastric Epithelial AGS Cells.
Lee, YM; Kim, MJ; Kim, Y; Kim, H
Journal of cancer prevention null
M Ernst et al.
The Journal of biological chemistry, 274(14), 9729-9737 (1999-03-27)
Cell type-specific responses to the leukemia inhibitory factor (LIF)/interleukin 6 cytokine family are mediated by dimerization of the LIF receptor alpha-chain (LIFRalpha) with the signal transducer gp130 or of two gp130 molecules followed by activation of the JAK/STAT and Ras/mitogen-activated
Differentiation of oligodendroglial progenitors derived from cortical multipotent cells requires extrinsic signals including activation of gp130/LIFbeta receptors
Marmur, R., et al
The Journal of Neuroscience, 18, 9800-9811 (1998)
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique