Direkt zum Inhalt
Merck

WH0002191M1

Sigma-Aldrich

Monoclonal Anti-FAP antibody produced in mouse

clone 1E5, purified immunoglobulin, buffered aqueous solution

Synonym(e):

Anti-DPPIV, Anti-FAPA, Anti-SEPRASE, Anti-fibroblast activation protein, alpha

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

MDL-Nummer:
UNSPSC-Code:
12352203
NACRES:
NA.41

Biologische Quelle

mouse

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

1E5, monoclonal

Form

buffered aqueous solution

Speziesreaktivität

human

Methode(n)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG2aκ

GenBank-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

dry ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... FAP(2191)

Allgemeine Beschreibung

Fibroblast activation protein (FAP), a cell-surface type II transmembrane glycoprotein serine protease, has a cytoplasmic tail, a single transmembrane domain, and an extracellular domain. It is a member of the S9b family of post-proline cleaving enzymes. FAP is localized in the plasma membrane. FAP gene is mapped to human chromosome 2q24.2. Expression of FAP is hardly seen in adult tissues.

Immunogen

FAP (AAH26250, 525 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS

Anwendung

Monoclonal Anti-FAP antibody produced in mouse has been used in western blotting.

Biochem./physiol. Wirkung

Fibroblast activation protein (FAP) participates in the remodeling of tissue, wound healing, inflammation, fibrosis, and tumor development. It possesses dipeptidyl peptidase and endopeptidase activities. FAP plays a key role in the remodeling of extracellular matrix structure and the reconstruction of tumor microarray. Overexpression of the FAP gene might return epithelial ovarian cancer after chemotherapy. FAP gene expression is involved in cancer cells and premalignant metaplastic cells of the esophagus.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Min Li et al.
BMC cancer, 20(1), 1032-1032 (2020-10-29)
High-grade serous ovarian cancer (HGSOC) is a fatal form of ovarian cancer. Previous studies indicated some potential biomarkers for clinical evaluation of HGSOC prognosis. However, there is a lack of systematic analysis of different expression genes (DEGs) to screen and
FAP (fibroblast activation protein alpha)
Tuncer S and Banerjee S
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2020)
Xin Maggie Wang et al.
Frontiers in bioscience : a journal and virtual library, 13, 3168-3180 (2007-11-06)
Fibroblast activation protein (FAP) is the member of Dipeptidyl Peptidase IV (DPIV) gene family that is most similar to DPIV. Four members of this family, DPIV, FAP, DP8 and DP9 possess a rare catalytic activity, hydrolysis of a prolyl bond
Hannelore Denys et al.
Cancer letters, 266(2), 263-274 (2008-04-22)
Several studies indicate that cancer-associated fibroblasts play a critical role in cancer cell invasion and metastasis, the hallmarks of malignancy. To better understand the mechanisms underlying such effects, we established a heterotypic model of human fibroblasts (primary colon fibroblasts and
Youfei Li et al.
The International journal of developmental biology, 58(5), 349-353 (2014-10-31)
Preeclampsia is a severe pregnancy complication in part due to insufficient implantation. This study aimed at elucidating the mechanism of action of dipeptidyl peptidase IV (DPPIV) in preeclampsia. Small activating RNAs (saRNA) were used to upregulate DPPIV expression in human

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.