SAB2109038

Anti-SLC6A9 (N-terminal) antibody produced in rabbit

affinity isolated antibody

• UNSPSC-Code: 12352203

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 72 kDa
• Speziesreaktivität (Voraussage durch Homologie): horse, human, mouse, guinea pig, canine, rabbit, bovine, rat
• Konzentration: 0.5 mg/mL
• Methode(n): western blot: 1 μg/mL
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SLC6A9(57396)

Beschreibung

Allgemeine Beschreibung

SLC6A9 terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. It may play a role in regulation of glycine levels in NMDA receptor-mediated neurotransmission.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human SLC6A9

Sequenz

Synthetic peptide located within the following region: ARPRMAAAHGPVAPSSPEQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSV

Physikalische Form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable