SAB2108772

Anti-PAX2 antibody produced in rabbit biotin conjugated

affinity isolated antibody

• Synonym(e): CPT1-M, CPT1M, CPTI, KIAA1670, M-CPT1
• UNSPSC-Code: 12352203
• NACRES: NA.45

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: biotin conjugate
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 42 kDa
• Speziesreaktivität (Voraussage durch Homologie): guinea pig, rat, horse, canine, mouse, rabbit, bovine, zebrafish, human
• Konzentration: 0.5 mg/mL
• NCBI-Hinterlegungsnummer: NM_000278
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PAX2(5076)

Beschreibung

Allgemeine Beschreibung

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia.

Immunogen

Synthetic peptide directed towards the middle region of Human PAX2

Sequenz

Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR

Physikalische Form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable