SAB2104536

Anti-U2AF1, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-DKFZp313J1712, Anti-FP793, Anti-RN, Anti-RNU2AF1, Anti-U2AF35
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 28 kDa
• Speziesreaktivität: dog, bovine, human, mouse, horse, rat, guinea pig, rabbit
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NM_001025203
• UniProt-Hinterlegungsnummer: Q01081
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... U2AF1(7307)

Beschreibung

Allgemeine Beschreibung

The previously assigned protein identifier Q701P4 has been merged into Q01081. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the N terminal region of human U2AF1

Biochem./physiol. Wirkung

This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which pl

Sequenz

Synthetic peptide located within the following region: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable