SAB2102223

Anti-SLC6A15 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-DKFZp761I0921, Anti-FLJ10316, Anti-MGC87066, Anti-NTT73, Anti-Solute carrier family 6, member 15
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 82 kDa
• Speziesreaktivität: dog, horse, human, rabbit, bovine
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• UniProt-Hinterlegungsnummer: Q9H2J7
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SLC6A15(55117)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC6A15

Biochem./physiol. Wirkung

SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.

Sequenz

Synthetic peptide located within the following region: DQCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMT

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable