SAB2100585

Anti-DIS3 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-DIS3 mitotic control homolog (S. cerevisiae), Anti-DKFZp667L1817, Anti-FLJ10484, Anti-KIAA1008, Anti-MGC33035
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 109 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• UniProt-Hinterlegungsnummer: Q9Y2L1
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... DIS3(22894)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human DIS3

Biochem./physiol. Wirkung

DIS3, belonging to the ribonuclease II (RNB) family, has a 3′-5′ exonuclease activity. It is a catalytic component of the exosome 3′→5′ exoribonuclease complex required for the 3′-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay. The protein is implicated in mitotic control and essential for cell division and spore germination. It may be involved in regulating protein dephosphorylation during mitosis.

Sequenz

Synthetic peptide located within the following region: DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable