SAB1411193

Anti-RGS3 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonym(e): C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ-RGS3, RGP3
• UNSPSC-Code: 12352203
• NACRES: NA.41
• Konjugat: unconjugated
• application: WB
• Klon: polyclonal
• Speziesreaktivität: human
• Methode(n): western blot: 1 μg/mL

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen 19.5 kDa
• Speziesreaktivität: human
• Methode(n): western blot: 1 μg/mL
• NCBI-Hinterlegungsnummer: NM_134427
• UniProt-Hinterlegungsnummer: P49796
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... RGS3(5998)

Beschreibung

Allgemeine Beschreibung

This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known. (provided by RefSeq)

Immunogen

RGS3 (NP_602299.1, 1 a.a. ~ 168 a.a) full-length human protein.

Sequence
MKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable