SAB1403345

Monoclonal Anti-KIF9, (C-terminal) antibody produced in mouse

clone 4E9, purified immunoglobulin, buffered aqueous solution

• Synonym(e): MGC104186
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 4E9, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~37 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_182902
• UniProt-Hinterlegungsnummer: Q9HAQ2
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... KIF9(64147)

Beschreibung

Allgemeine Beschreibung

KIF9 (Kinesin family member 9) is a microtubule-associated protein belonging to the kinesin 9 motor family. It is localized in the mitotic spindle.

Mouse monoclonal antibody raised against a partial recombinant KIF9.

Immunogen

KIF9 (NP_878905.1, 691 a.a. ~ 789 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR

Anwendung

Monoclonal Anti-KIF9, (C-terminal) antibody produced in mouse is suitable for western blot and indirect ELISA.

Biochem./physiol. Wirkung

KIF9 (Kinesin family member 9) is involved in the regulation of spindle dynamics In terms of chromosome organization, spindle length control, and mitotic progression. It forms a complex by binding to the GEM, a small GTP-binding protein, in mitotic cells and the complex controls spindle length. It also retards microtubule growth. In primary macrophage of humans, KIF9 controls morphology and numbers of the podosomes and its ability to degrade matrix material.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable