SAB1403313

Monoclonal Anti-PEO1, (C-terminal) antibody produced in mouse

clone 1C5, purified immunoglobulin, buffered aqueous solution

• Synonym(e): PEO
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1C5, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~36.45 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_021830
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... C10orf2(56652)

Beschreibung

Allgemeine Beschreibung

This gene encodes a hexameric DNA helicase which unwinds short stretches of double-stranded DNA in the 5′ to 3′ direction and, along with mitochondrial single-stranded DNA binding protein and mtDNA polymerase gamma, is thought to play a key role in mtDNA replication. The protein localizes to the mitochondrial matrix and mitochondrial nucleoids. Mutations in this gene cause infantile onset spinocerebellar ataxia (IOSCA) and progressive external ophthalmoplegia (PEO) and are also associated with several mitochondrial depletion syndromes. Alternative splicing results in multiple transcript variants encoding distinct isoforms

Immunogen

PEO1 (NP_068602.2, 591 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPDTSKRSK

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable