SAB1402761

Monoclonal Anti-EFNA3 antibody produced in mouse

clone 1C12, purified immunoglobulin, buffered aqueous solution

• Synonym(e): EFL2, EPLG3, Ehk1-L, LERK3
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1C12, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~52.29 kDa
• Speziesreaktivität: human
• Methode(n): capture ELISA: suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable
• Isotyp: IgG1κ
• NCBI-Hinterlegungsnummer: BC017722
• UniProt-Hinterlegungsnummer: P52797
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... EFNA3(1944)

Beschreibung

Allgemeine Beschreibung

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. (provided by RefSeq)

Immunogen

EFNA3 (AAH17722, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable