SAB1402522

Monoclonal Anti-PITRM1 antibody produced in mouse

clone 1H3, purified immunoglobulin, buffered aqueous solution

• Synonym(e): KIAA1104, MGC138192, MGC141929, MP1, PreP, hMP1
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1H3, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~84.48 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: BC001150
• UniProt-Hinterlegungsnummer: Q5JRX3
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PITRM1(10531)

Beschreibung

Immunogen

PITRM1 (AAH01150, 1 a.a. ~ 534 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQIYEKGLELRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLAILGPENPKIAKDPSWIIR

Biochem./physiol. Wirkung

PITRM1 (Pitrilysin metallopeptidase 1) acts as a mitochondrial amyloid-β peptide (Aβ)-degrading enzyme localized in the mitochondrial matrix. Its activity is controlled by Zn(+2)-dependent metalloprotease inhibitor. The temporal lobe of the human brain has a high tendency of Aβ accumulation and reactive oxygen species (ROS) production. In Alzheimer′s disease, the low proteolytic activity of PITRM1 in the brain mitochondria has been reported. Studies have been suggested that high ROS production results in decreased PITRM1 activity followed by Aβ accumulation. As a result, it leads to the mitochondrial toxicity and neuronal death. Thus, it proves the impact of PITRM1 in the Alzheimer′s disease.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable