MSST0060

SILu^™Lite CST3, Cystatin C human

recombinant, expressed in E. coli, MS Protein Standard

• Synonym(e): CST3, Cystatin C
• UNSPSC-Code: 23201100
• NACRES: NA.32

Eigenschaften

• Rekombinant: expressed in E. coli
• Qualitätsniveau: 200
• Assay: ≥95% (SDS-PAGE)
• Form: lyophilized powder
• Eignung: suitable for mass spectrometry (internal calibrator)
• UniProt-Hinterlegungsnummer: P01034 (aa 27-146)
• Versandbedingung: ambient
• Lagertemp.: −20°C
• Angaben zum Gen: human ... CST3(1471)

Beschreibung

Allgemeine Beschreibung

SILu^™Lite CST3 is a recombinant human protein expressed in E. coli. It consists of 120 amino acids, with a calculated molecular mass of 13.5 kDa. SILu^™Lite CST3 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Biochem./physiol. Wirkung

Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).

Sequenz

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Physikalische Form

Supplied as a lyophilized powder containing tris buffered saline and methionine.

Rechtliche Hinweise

SILu is a trademark of Sigma-Aldrich Co. LLC

Sicherheitshinweise

• Lagerklassenschlüssel: 11 - Combustible Solids
• WGK: WGK 2
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable