HPA060499

Anti-SOX5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody

• Synonym(e): L-SOX5, MGC35153
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA060499
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: 0.25-2 μg/mL
• Immunogene Sequenz: VEEEESDGLPAFHLPLHVSFPNKPHSEEFQPVSLLTQETCGHRTPTSQHNTMEVDGNKVMSSFAPHNSSTSPQKAEEGGRQSGESLSSTALG
• UniProt-Hinterlegungsnummer: P35711
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SOX5(6660)

Beschreibung

Allgemeine Beschreibung

Sex determining region Y(SRY) HMG (High mobility group) box 5 (SOX5) belongs to the family of transcription factors which is involved in early developmental stage. Sox proteins are classified into 6 subfamily groups based on their homology and SOX5 belongs to subfamily D. The group D subfamily share a conserved N terminal domain which has leucine zipper, coiled-coil domain, Glutamine rich region (Q box).Sox5 has two variants, long and short, of which, short is a part of long with N-terminal region. Short form of Sox5 is expressed in testis and long form of Sox5 (LSox5) is expressed different organs including chondrocytes and striated muscles. LSox5 and Sox6 are highly similar. In human chromosome, the gene is localized on 12p12.1.

Immunogen

SRY (sex determining region Y)-box 5

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

SOX5 (Sry-type HMG box 5) is involved in the development of cartilage and skeletal muscles. Sox5 and Sox6 along with Sox9 regulates chondrocyte differentiation. Mutations in SOX5 leads to deformity of skeletal muscles. Inactivation of Sox5 leads to death of the baby at birth due to respiratory distress. The short form of Sox5 is involved in spermatid cells differentiation and spermiogenesis in the testis. Sox5 is also involved in the development of certain neuronal cell types. Haploinsufficiency or deletion of Sox5 leads to intellectual disability and developmental delays.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST89908

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable