HPA055619

Anti-DEPDC5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): DEPDC5 Antibody - Anti-DEPDC5 antibody produced in rabbit, Depdc5 Antibody, Anti-DEP domain containing 5, Anti-DEP.5, Anti-KIAA0645
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA055619
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: 0.25-2 μg/mL
• Immunogene Sequenz: YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS
• UniProt-Hinterlegungsnummer: O75140
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... DEPDC5(9681)

Beschreibung

Allgemeine Beschreibung

The DEP domain containing 5 (DEPDC5) gene encodes DEP domain-containing protein 5. DEPDC5 protein is made of five functional domains, such as N-terminal domain, a steric hindrance for enhancement of nucleotidase activity domain, disheveled, egl-10, and pleckstrin (DEP) domain, the structural axis for binding arrangement domain, and C-terminal domain. The DEPDC5 gene is located on the human chromosome at 22q12.2-q12.3.

Immunogen

DEP domain containing 5 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-DEPDC5 antibody produced in rabbit has been used in immunofluorescence (1:100).

Biochem./physiol. Wirkung

DEP domain containing 5 (DEPDC5) acts as a negative regulator of mammalian target of rapamycin complex 1 (mTORC1). It is a part of the GTPase-activating protein activity. Mutations in the DEPDC gene that lead to autosomal dominant familial focal epilepsy with variable foci (FFEVF), familial temporal lobe epilepsy, and autosomal dominant nocturnal frontal lobe epilepsy.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST78172

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable