Direkt zum Inhalt
Merck

HPA037837

Sigma-Aldrich

Anti-IPMK antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-Inositol polyphosphate multikinase

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

recombinant expression
Learn more about Antibody Enhanced Validation

Methode(n)

immunofluorescence: 0.25-2 μg/mL

Immunogene Sequenz

DCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSD

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... IPMK(253430)

Allgemeine Beschreibung

The gene encoding inositol polyphosphate multikinase (IPMK) enzyme is located on human chromosome 10q21.1. IPMK consists of inositol phosphate binding, nuclear localization signal, and ATP-binding kinase domain. It is a catalytically flexible enzyme and is part of intracellular signalling network.

Immunogen

inositol polyphosphate multikinase recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-IPMK antibody produced in rabbit may be used for the detection of IPMK protein in
  • lymphoblasts by immunoprecipitation
  • human adenocarcinogenic cell lines by western blotting
  • in mouse 3T3 cells by western blotting

Biochem./physiol. Wirkung

Inositol polyphosphate multikinase (IPMK) indirectly mediates mRNA transport from nucleus to cytoplasm by mediating synthesis of phosphatidylinositol levels. IPMK interacts and stabilizes tumor necrosis factor receptor in HEK293T cells.IPMK coordinates with various signaling networks. Its deletion impairs immune response signalling pathways. Knockdown of IPMK leads to imbalance in the inositol polyphosphates. IPMK binds to tumor suppressor protein and regulates transcription and cell death. Mutation in the IPMK gene results in a truncated protein with reduced kinase activity. IPMK gene deletion or RNA interference results in cell growth inhibition. IPMK is regarded as prime target for tumor suppression. Pathology of Huntington′s disease is associated with IPMK protein depletion. In Alzheimer′s patients, low IPMK transcript levels may play a key in neurodegeneration.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST80294

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

The human homolog of the rat inositol phosphate multikinase is an inositol 1, 3, 4, 6-tetrakisphosphate 5-kinase
Chang , et al.
The Journal of Biological Chemistry, 277(46), 43836-43843 (2002)
Structural features of human inositol phosphate multikinase rationalize its inositol phosphate kinase and phosphoinositide 3-kinase activities.
Wang H and Shears SB
The Journal of Biological Chemistry, jbc-M117 (2017)
Huntington?s disease: Neural dysfunction linked to inositol polyphosphate multikinase
Ahmed I, et al.
Proceedings of the National Academy of Sciences of the USA, 112(31), 9751-9756 (2015)
Inositol polyphosphate multikinase is a physiologic PI3-kinase that activates Akt/PKB
Maag D, et al.
Proceedings of the National Academy of Sciences of the USA, 108(4), 1391-1396 (2011)
The Regulation of Runx2 by FGF2 and Connexin43 Requires the Inositol Polyphosphate/Protein Kinase Cdelta Cascade
Niger C, et al.
Journal of Bone and Mineral Research, 28(6), 1468-1468 (2013)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.