HPA034982

Anti-ABCB7 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-ABC7, Anti-ASAT, Anti-ATP-binding cassette, sub-family B (MDR/TAP), member 7, Anti-Atm1p, Anti-EST140535
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA034982
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI
• UniProt-Hinterlegungsnummer: O75027
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ABCB7(22)

Beschreibung

Allgemeine Beschreibung

ATP binding cassette subfamily B member 7 transporter protein (ABCB7) is located in mitochondrial inner membrane and encoded by ABACB7 gene on human chromosome Xq13.3. It has ATP binding cassette domain and belongs to the multidrug resistance/ transporter antigenic peptides MDR/TAP subfamily.

Immunogen

ATP-binding cassette, sub-family B (MDR/TAP), member 7 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-ABCB7 antibody produced in rabbit has been used for the detection of ABCB7 protein in immunoblotting.

Biochem./physiol. Wirkung

ATP binding cassette subfamily B member 7 transporter protein (ABCB7) is involved in the transport of heme from the mitochondria to the cytosol. It is also involved in heme biosynthesis and homeostasis. Silencing of ABCB7 RNA and mutations in ABCB7 is implicated in sideroblastic anemia with ataxia. Alternate splicing of ABC7 gene results in premature protein termination and is associated with myelodysplastic syndromes.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST78281

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable