Direkt zum Inhalt
Merck

HPA024372

Sigma-Aldrich

Anti-S100A8 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-CFAG, Anti-Calgranulin-A, Anti-Calprotectin L1L subunit, Anti-Cystic fibrosis antigen, Anti-Leukocyte L1 complex light chain, Anti-MRP-8, Anti-Migration inhibitory factor-related protein 8, Anti-P8, Anti-Protein S100-A8, Anti-S100 calcium-binding protein A8

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Methode(n)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:2500-1:5000

Immunogene Sequenz

LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... S100A8(6279)

Allgemeine Beschreibung

The gene S100A8 (S100 calcium-binding protein A8) is mapped to human chromosome 1q21. It is a small calcium-binding protein, which is strongly expressed in neutrophils. In presence of cell stimulation, it is also expressed in monocytes, macrophages, platelets and epithelial and endothelial cells. S100A8 protein is present as a homodimer as well as heterodimer (S100A8/A9). The protein has two EF-hand motifs and one high-affinity Ca2+ binding site. S100A8 is also referred to as myeloid-related protein 8 (MRP8) or calgranulin A.

Immunogen

Protein S100-A8 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-S100A8 antibody produced in rabbit has been used in immunohistochemistry and immunofluorescence.

Biochem./physiol. Wirkung

S100A8 (S100 calcium-binding protein A8) is mainly present at the inflammation site or in the serum during acute and chronic inflammation. It is responsible for neutrophil recruitment, attachment and release from the bone marrow. S100A8 is required for sending neutrophils to the site of inflammation in presence of bacterial infection, lipopolysaccharide, and monosodium urate crystals. It is also involved in granulocyte and monocyte attachment to endothelium and also their transport across endothelial cells. The S100A8/A9 heterodimer induces monocyte migration and cytokine secretion. In presence of falciparum malaria, high levels of S100A8 are present in the blood.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST70709

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Gabriella Béke et al.
Frontiers in immunology, 9, 424-424 (2018-03-21)
The immunological barrier of the healthy skin is considered to be unified on the whole body surface-however, recent indirect findings have challenged this dogma since microbial and chemical milieu (e.g., sebum, sweat, and pH) exhibit remarkable differences on topographically distinct
Up-regulated S100 calcium binding protein A8 in Plasmodium-infected patients correlates with CD4(+)CD25(+)Foxp3 regulatory T cell generation.
Kim TS, et al.
Malaria Journal, 14, 385-385 (2015)
mRNA Expression of S100A8 as a Prognostic Marker for Progression of Non-Muscle-Invasive Bladder Cancer.
Ha YS, et al.
Korean Journal of Urology, 51, 15-20 (2010)
Secretion of S100A8, S100A9, and S100A12 by Neutrophils Involves Reactive Oxygen Species and Potassium Efflux.
Tardif MR, et al.
Journal of immunology research, 296149-296149 (2015)
Zhiwei Sun et al.
Cell death & disease, 11(8), 650-650 (2020-08-20)
Metastasis is the main cause of failure of cancer treatment. Metastatic colonization is regarded the most rate-limiting step of metastasis and is subjected to regulation by a plethora of biological factors and processes. On one hand, regulation of metastatic colonization

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.